PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6BL_35444DAF9.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family FAR1
Protein Properties Length: 227aa    MW: 25203.8 Da    PI: 8.5463
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6BL_35444DAF9.2genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR127.21.3e-0832715190
                   FAR1 51 errtraetrtgCkaklkvkkekdgkwevtkleleHnHela 90
                           ++ ++ + r+ C a++++ +++d+ w++t  +++HnH+l+
  Traes_6BL_35444DAF9.2 32 KKGNKRTCRCRCPAMIRLLRSSDNGWYITYYRSDHNHALT 71
                           56678899******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031016.8E-63371IPR004330FAR1 DNA binding domain
Sequence ? help Back to Top
Protein Sequence    Length: 227 aa     Download sequence    Send to blast
MSGDCPLCSS LRAIYGERRP SSPCLGEKGI PKKGNKRTCR CRCPAMIRLL RSSDNGWYIT  60
YYRSDHNHAL TERCGEKVYW PSHKHIDIYT RDVIKQLREN NISVGKVYNI IGSFFGSMTN  120
IPFTKRALRG LCGKMSGEQA DNDVKKTMDV FAELGAKDSG LYCRVQPDVF AELGGKDSEL  180
SLSAADSQLS TAKDDPQAPG GQKGFVLDEP LSNVHLVLDE CVPLKKH
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
13036PKKGNKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014753620.14e-53PREDICTED: putative protein FAR1-RELATED SEQUENCE 10
TrEMBLW5GIU11e-171W5GIU1_WHEAT; Uncharacterized protein
STRINGBRADI2G07910.15e-53(Brachypodium distachyon)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP6191991
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]